Mouse Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit

Mouse Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit

To Order Contact Us:  [email protected]

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-48T 48T
EUR 609.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

DLR-Ab1-40-Ra-96T 96T
EUR 793.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-48Tests 48 Tests
EUR 573.6

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Hu-96Tests 96 Tests
EUR 794.4

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-48Tests 48 Tests
EUR 613.2

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RD-Ab1-40-Ra-96Tests 96 Tests
EUR 850.8

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-48Tests 48 Tests
EUR 600

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Hu-96Tests 96 Tests
EUR 830.4

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-48Tests 48 Tests
EUR 640.8

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

RDR-Ab1-40-Ra-96Tests 96 Tests
EUR 890.4

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

20-abx153576
  • EUR 7970.40
  • EUR 4250.40
  • EUR 990.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

20-abx053394
  • EUR 8365.20
  • EUR 4456.80
  • EUR 1036.80
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx255205-96tests 96 tests
EUR 801.6

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-10x96wellstestplate 10x96-wells test plate
EUR 5269.39
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-1x48wellstestplate 1x48-wells test plate
EUR 539.12
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-1x96wellstestplate 1x96-wells test plate
EUR 718.75
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Mu-5x96wellstestplate 5x96-wells test plate
EUR 2874.38
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

4-CEA864Mu
  • EUR 5330.40
  • EUR 2815.20
  • EUR 718.80
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

ED1032-096 96T
EUR 1113.6

Mouse Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)

RK02558 96 Tests
EUR 625.2

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx132222
  • EUR 510.00
  • EUR 159.60
  • EUR 1412.40
  • EUR 693.60
  • EUR 393.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx175368
  • EUR 477.60
  • EUR 159.60
  • EUR 1312.80
  • EUR 644.40
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Amyloid Beta Peptide 1-40 (Ab1-40) Antibody

20-abx175369
  • EUR 493.20
  • EUR 159.60
  • EUR 1362.00
  • EUR 661.20
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Synthetic Amyloid Beta Peptide 1-40 (Ab1-40)

4-SPA864Hu02
  • EUR 421.06
  • EUR 236.40
  • EUR 1248.96
  • EUR 496.32
  • EUR 872.64
  • EUR 357.60
  • EUR 2942.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

20-abx652283
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide

abx670346-1mg 1 mg
EUR 627.6

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)

20-abx651146
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

20-abx651147
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)

20-abx651148
  • EUR 410.40
  • EUR 260.40
  • EUR 1078.80
  • EUR 493.20
  • EUR 326.40
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit

20-abx490288
  • EUR 9567.60
  • EUR 5095.20
  • EUR 1177.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

20-abx150496
  • EUR 7970.40
  • EUR 4250.40
  • EUR 990.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

20-abx155127
  • EUR 8684.40
  • EUR 4626.00
  • EUR 1074.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx053393-96tests 96 tests
EUR 801.6

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

20-abx053396
  • EUR 8684.40
  • EUR 4626.00
  • EUR 1074.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Chicken Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx357155-96tests 96 tests
EUR 990

Pig Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx361651-96tests 96 tests
EUR 990

Rabbit Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx362577-96tests 96 tests
EUR 990

Monkey Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx353340-96tests 96 tests
EUR 990

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

abx256723-96tests 96 tests
EUR 801.6

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-10x96wellstestplate 10x96-wells test plate
EUR 5128.02
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-1x48wellstestplate 1x48-wells test plate
EUR 527.48
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-1x96wellstestplate 1x96-wells test plate
EUR 702.12
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Hu-5x96wellstestplate 5x96-wells test plate
EUR 2799.54
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

4-CEA864Hu
  • EUR 5188.80
  • EUR 2739.60
  • EUR 703.20
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-10x96wellstestplate 10x96-wells test plate
EUR 5552.14
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-1x48wellstestplate 1x48-wells test plate
EUR 562.42
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-1x96wellstestplate 1x96-wells test plate
EUR 752.02
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

CEA864Ra-5x96wellstestplate 5x96-wells test plate
EUR 3024.07
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids.

Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

4-CEA864Ra
  • EUR 5612.40
  • EUR 2965.20
  • EUR 752.40
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit

ED1031-096 96T
EUR 1064.4

Human Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)

RK00784 96 Tests
EUR 625.2

Rat Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40)

RK03455 96 Tests
EUR 625.2

ELISA kit for Mouse Ab1-40 (Amyloid Beta Peptide 1-40)

ELK1493 1 plate of 96 wells
EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Hu11
  • EUR 266.23
  • EUR 194.40
  • EUR 668.35
  • EUR 302.78
  • EUR 485.57
  • EUR 253.20
  • EUR 1490.88
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Hu21
  • EUR 517.82
  • EUR 261.60
  • EUR 1611.84
  • EUR 617.28
  • EUR 1114.56
  • EUR 422.40
  • EUR 3849.60
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Hu23
  • EUR 409.22
  • EUR 232.80
  • EUR 1204.61
  • EUR 481.54
  • EUR 843.07
  • EUR 349.20
  • EUR 2831.52
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Hu31
  • EUR 295.26
  • EUR 202.80
  • EUR 777.22
  • EUR 339.07
  • EUR 558.14
  • EUR 272.40
  • EUR 1763.04
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Mu11
  • EUR 266.23
  • EUR 194.40
  • EUR 668.35
  • EUR 302.78
  • EUR 485.57
  • EUR 253.20
  • EUR 1490.88
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Mu21
  • EUR 266.23
  • EUR 194.40
  • EUR 668.35
  • EUR 302.78
  • EUR 485.57
  • EUR 253.20
  • EUR 1490.88
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Mu31
  • EUR 295.26
  • EUR 202.80
  • EUR 777.22
  • EUR 339.07
  • EUR 558.14
  • EUR 272.40
  • EUR 1763.04
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Ra11
  • EUR 266.23
  • EUR 194.40
  • EUR 668.35
  • EUR 302.78
  • EUR 485.57
  • EUR 253.20
  • EUR 1490.88
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Ra21
  • EUR 266.23
  • EUR 194.40
  • EUR 668.35
  • EUR 302.78
  • EUR 485.57
  • EUR 253.20
  • EUR 1490.88
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40)

4-CPA864Ra31
  • EUR 295.26
  • EUR 202.80
  • EUR 777.22
  • EUR 339.07
  • EUR 558.14
  • EUR 272.40
  • EUR 1763.04
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

20-abx165634
  • EUR 727.20
  • EUR 309.60
  • EUR 2180.40
  • EUR 861.60
  • EUR 526.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)

20-abx651143
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

20-abx651144
  • EUR 577.20
  • EUR 292.80
  • EUR 1646.40
  • EUR 678.00
  • EUR 410.40
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)

20-abx651145
  • EUR 410.40
  • EUR 260.40
  • EUR 1078.80
  • EUR 493.20
  • EUR 326.40
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA)

20-abx651149
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA)

20-abx651150
  • EUR 376.80
  • EUR 243.60
  • EUR 927.60
  • EUR 410.40
  • EUR 309.60
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH)

20-abx651151
  • EUR 410.40
  • EUR 260.40
  • EUR 1078.80
  • EUR 493.20
  • EUR 326.40
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Human Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit

20-abx490287
  • EUR 9567.60
  • EUR 5095.20
  • EUR 1177.20
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Rat Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit

20-abx490289
  • EUR 10282.80
  • EUR 5472.00
  • EUR 1262.40
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

ELISA kit for Human Ab1-40 (Amyloid Beta Peptide 1-40)

ELK1492 1 plate of 96 wells
EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Rat Ab1-40 (Amyloid Beta Peptide 1-40)

ELK1494 1 plate of 96 wells
EUR 518.4
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Rat in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat)

4-PAA864Ra08
  • EUR 291.60
  • EUR 2948.40
  • EUR 735.60
  • EUR 366.00
  • EUR 254.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40)

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit

STJ150003 1 kit
EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC

4-PAA864Ra08-APC
  • EUR 408.00
  • EUR 3843.60
  • EUR 1072.80
  • EUR 518.40
  • EUR 260.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Biotinylated

4-PAA864Ra08-Biotin
  • EUR 368.40
  • EUR 2888.40
  • EUR 856.80
  • EUR 450.00
  • EUR 260.40
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Biotin.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Cy3

4-PAA864Ra08-Cy3
  • EUR 493.20
  • EUR 5074.80
  • EUR 1381.20
  • EUR 642.00
  • EUR 297.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Cy3.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), FITC

4-PAA864Ra08-FITC
  • EUR 350.40
  • EUR 3098.40
  • EUR 882.00
  • EUR 439.20
  • EUR 232.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with FITC.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), HRP

4-PAA864Ra08-HRP
  • EUR 373.20
  • EUR 3350.40
  • EUR 949.20
  • EUR 469.20
  • EUR 246.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with HRP.

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), PE

4-PAA864Ra08-PE
  • EUR 350.40
  • EUR 3098.40
  • EUR 882.00
  • EUR 439.20
  • EUR 232.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with PE.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08300m
  • EUR 1135.20
  • EUR 6938.40
  • EUR 3672.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit

STJ150127 1 kit
EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-02744M1 96T
EUR 553.2

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-02744M2 48T
EUR 372

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0318MS-48T 48T
EUR 403.2

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0318MS-96T 96T
EUR 640.8

Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E20080 96T
EUR 433.2

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0422MO-48T 48T
EUR 465

Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0422MO-96T 96T
EUR 600

Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC-Cy7

4-PAA864Ra08-APC-Cy7
  • EUR 672.00
  • EUR 7543.20
  • EUR 2002.80
  • EUR 894.00
  • EUR 378.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC-Cy7.

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08299h
  • EUR 1080.00
  • EUR 6571.20
  • EUR 3480.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

1-CSB-E08302r
  • EUR 1160.40
  • EUR 7110.00
  • EUR 3760.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

CSB-E08300m-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-00638R1 96T
EUR 577.2

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-00638R2 48T
EUR 398.4

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-03356H1 96T
EUR 544.8

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-03356H2 48T
EUR 363.6

Horse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-05164H1 96T
EUR 556.8

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

CN-01866R1 96T
EUR 592.8

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E1247HM-48T 48T
EUR 346.8

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E1247HM-96T 96T
EUR 559.2

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0029RB-48T 48T
EUR 391.2

Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0029RB-96T 96T
EUR 628.8

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0086PC-48T 48T
EUR 436.8

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

GA-E0086PC-96T 96T
EUR 708

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0101RT-48T 48T
EUR 380.4

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

GA-E0101RT-96T 96T
EUR 595.2

Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E04414 96T
EUR 433.2

Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

QY-E11552 96T
EUR 433.2

Equine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

QY-E120008 96T
EUR 573.6

Canine Amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

YLA0030CA-48T 48T
EUR 502.5

Canine Amyloid beta peptide 1-40(Aβ1-40)ELISA Kit

YLA0030CA-96T 96T
EUR 618.75

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0171PO-48T 48T
EUR 502.5

Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0171PO-96T 96T
EUR 618.75

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0371RA-48T 48T
EUR 465

Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA0371RA-96T 96T
EUR 600

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA1751HU-48T 48T
EUR 435

Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit

YLA1751HU-96T 96T
EUR 562.5

Mouse amyloid beta peptide 1-40 ELISA kit

E03A0910-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit

E03A0910-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit

E03A0910-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat beta-40(Amyloid Beta 1-40) ELISA Kit

STJ150091 1 kit
EUR 494.4
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids

Abeta 40 (beta amyloid 1-40)

RA25009 100 ul
EUR 459.6

Human amyloid beta peptide 1-40,A?1-40 ELISA Kit

201-12-1231 96 tests
EUR 528
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

CSB-E08299h-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aβ1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat amyloid beta peptide 1-40, Aβ1-40 ELISA Kit

CSB-E08302r-24T 1 plate of 24 wells
EUR 198
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aβ1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Amyloid Beta-Peptide (1-40) (human)

A1124-10 10 mg
EUR 895.2
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-25 25 mg
EUR 1228.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-5 5 mg
EUR 560.4
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

beta-Amyloid(40-1)

5-00456 4 x 1mg Ask for price

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit

E02A0910-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit

E02A0910-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit

E02A0910-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit

E09A0910-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit

E09A0910-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit

E09A0910-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit

E06A0910-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit

E06A0910-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit

E06A0910-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit

E08A0910-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit

E08A0910-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit

E08A0910-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig amyloid beta peptide 1-40 ELISA kit

E07A0910-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig amyloid beta peptide 1-40 ELISA kit

E07A0910-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig amyloid beta peptide 1-40 ELISA kit

E07A0910-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Equine amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864ELA-Eq 96 Tests
EUR 1113.6

Human amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864h 96 Tests
EUR 988.8

Monkey amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864Mo 96 Tests
EUR 1113.6

Rabbit amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864Rb 96 Tests
EUR 1113.6

Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

DLR-Ab1-42-Mu-48T 48T
EUR 586.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

DLR-Ab1-42-Mu-96T 96T
EUR 762
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids.

Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RD-Ab1-42-Mu-48Tests 48 Tests
EUR 586.8

Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RD-Ab1-42-Mu-96Tests 96 Tests
EUR 812.4

Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RDR-Ab1-42-Mu-48Tests 48 Tests
EUR 613.2

Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RDR-Ab1-42-Mu-96Tests 96 Tests
EUR 850.8

ELISA kit for Mouse A?1-40 (Amyloid Beta 1-40)

E-EL-M0067 1 plate of 96 wells
EUR 452.4
Description: A sandwich ELISA kit for quantitative measurement of Mouse A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit

KTE101179-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit

KTE101179-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit

KTE101179-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

40 x ELISA Wash Buffer

GR103014-40 1 L
EUR 238.8

Mouse/Rat Amyloid-beta (AB1-40) ELISA Kit, 96 tests, Quantitative

200-105-A40 1 kit
EUR 1074

Human Amyloid-beta (AB1-40) ELISA Kit, 96 tests, Quantitative

200-100-A40 1 kit
EUR 973.2

FUNNEL, 40 MM, PP

6120P-40 24/pk
EUR 52.8
Description: Reusable Plastics; Reusable Funnels

Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

DLR-Ab1-42-Hu-48T 48T
EUR 574.8
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

DLR-Ab1-42-Hu-96T 96T
EUR 745.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

DLR-Ab1-42-Ra-48T 48T
EUR 609.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids.

Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

DLR-Ab1-42-Ra-96T 96T
EUR 793.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids.

Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RD-Ab1-42-Hu-48Tests 48 Tests
EUR 573.6

Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RD-Ab1-42-Hu-96Tests 96 Tests
EUR 794.4

Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RD-Ab1-42-Ra-48Tests 48 Tests
EUR 613.2

Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RD-Ab1-42-Ra-96Tests 96 Tests
EUR 850.8

Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RDR-Ab1-42-Hu-48Tests 48 Tests
EUR 600

Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RDR-Ab1-42-Hu-96Tests 96 Tests
EUR 830.4

Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RDR-Ab1-42-Ra-48Tests 48 Tests
EUR 640.8

Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

RDR-Ab1-42-Ra-96Tests 96 Tests
EUR 890.4

Guinea pig amyloid beta peptide 1-40 ELISA kit

E05A0910-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig amyloid beta peptide 1-40 ELISA kit

E05A0910-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig amyloid beta peptide 1-40 ELISA kit

E05A0910-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

[Gln11] -beta- Amyloid (1 - 40)

5-00187 4 x 1mg Ask for price

[Gln22] -beta- Amyloid (1 - 40)

5-00190 4 x 1mg Ask for price

[Gly22] -beta- Amyloid (1 - 40)

5-00201 4 x 1mg Ask for price

beta-Amyloid (1-40), rat

5-00427 4 x 1mg Ask for price

Cys-beta- Amyloid (1 - 40)

5-01014 4 x 1mg Ask for price

Amyloid beta (1-40) Antibody

abx020617-100ug 100 ug
EUR 1178.4

ELISA kit for Human A?1-40 (Amyloid Beta 1-40)

E-EL-H0542 1 plate of 96 wells
EUR 452.4
Description: A sandwich ELISA kit for quantitative measurement of Human A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Rat A?1-40 (Amyloid Beta 1-40)

E-EL-R1401 1 plate of 96 wells
EUR 452.4
Description: A sandwich ELISA kit for quantitative measurement of Rat A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Monkey A?1-40 (Amyloid Beta 1-40)

E-EL-MK0477 1 plate of 96 wells
EUR 700.8
Description: A sandwich ELISA kit for quantitative measurement of Monkey A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant

Amyloid beta 40 antibody

10R-8435 100 ul
EUR 471.6
Description: Mouse monoclonal Amyloid beta 40 antibody

beta-Amyloid (11- 40)

5-00434 4 x 1mg Ask for price

Mouse Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit