Human Ab1-40(Amyloid Beta Peptide 1-40) ELISA Kit
To Order Contact Us: [email protected]
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
DLR-Ab1-40-Mu-48T | DL Develop | 48T | EUR 586.8 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
DLR-Ab1-40-Mu-96T | DL Develop | 96T | EUR 762 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
DLR-Ab1-40-Ra-48T | DL Develop | 48T | EUR 609.6 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
DLR-Ab1-40-Ra-96T | DL Develop | 96T | EUR 793.2 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
RD-Ab1-40-Mu-48Tests | Reddot Biotech | 48 Tests | EUR 586.8 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
RD-Ab1-40-Mu-96Tests | Reddot Biotech | 96 Tests | EUR 812.4 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
RD-Ab1-40-Ra-48Tests | Reddot Biotech | 48 Tests | EUR 613.2 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
RD-Ab1-40-Ra-96Tests | Reddot Biotech | 96 Tests | EUR 850.8 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
RDR-Ab1-40-Mu-48Tests | Reddot Biotech | 48 Tests | EUR 613.2 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
RDR-Ab1-40-Mu-96Tests | Reddot Biotech | 96 Tests | EUR 850.8 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
RDR-Ab1-40-Ra-48Tests | Reddot Biotech | 48 Tests | EUR 640.8 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
RDR-Ab1-40-Ra-96Tests | Reddot Biotech | 96 Tests | EUR 890.4 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide |
|||
20-abx652283 | Abbexa |
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide |
|||
abx670346-1mg | Abbexa | 1 mg | EUR 627.6 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
20-abx150496 | Abbexa |
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
abx053393-96tests | Abbexa | 96 tests | EUR 801.6 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Hu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5128.02 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Hu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 527.48 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Hu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 702.12 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Hu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2799.54 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
4-CEA864Hu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
ED1031-096 | GenDepot | 96T | EUR 1064.4 |
Human Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
|||
RK00784 | Abclonal | 96 Tests | EUR 625.2 |
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
|||
20-abx132222 | Abbexa |
|
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
|||
20-abx175368 | Abbexa |
|
|
Amyloid Beta Peptide 1-40 (Ab1-40) Antibody |
|||
20-abx175369 | Abbexa |
|
|
Synthetic Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-SPA864Hu02 | Cloud-Clone |
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: E.coli |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
20-abx155127 | Abbexa |
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
20-abx153576 | Abbexa |
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
20-abx053394 | Abbexa |
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
20-abx053396 | Abbexa |
|
|
Chicken Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
abx357155-96tests | Abbexa | 96 tests | EUR 990 |
Pig Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
abx361651-96tests | Abbexa | 96 tests | EUR 990 |
Rabbit Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
abx362577-96tests | Abbexa | 96 tests | EUR 990 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
abx255205-96tests | Abbexa | 96 tests | EUR 801.6 |
Monkey Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
abx353340-96tests | Abbexa | 96 tests | EUR 990 |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
abx256723-96tests | Abbexa | 96 tests | EUR 801.6 |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Mu-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5269.39 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Mu-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 539.12 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Mu-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 718.75 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Mu-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 2874.38 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
4-CEA864Mu | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Ra-10x96wellstestplate | Cloud-Clone | 10x96-wells test plate | EUR 5552.14 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Ra-1x48wellstestplate | Cloud-Clone | 1x48-wells test plate | EUR 562.42 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Ra-1x96wellstestplate | Cloud-Clone | 1x96-wells test plate | EUR 752.02 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
CEA864Ra-5x96wellstestplate | Cloud-Clone | 5x96-wells test plate | EUR 3024.07 |
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in serum, plasma and other biological fluids. |
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
4-CEA864Ra | Cloud-Clone |
|
|
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species. |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit |
|||
ED1032-096 | GenDepot | 96T | EUR 1113.6 |
Mouse Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
|||
RK02558 | Abclonal | 96 Tests | EUR 625.2 |
Rat Amyloid Beta Peptide 1-40 ELISA Kit (Ab1-40) |
|||
RK03455 | Abclonal | 96 Tests | EUR 625.2 |
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
|||
20-abx165634 | Abbexa |
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
|||
20-abx651143 | Abbexa |
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
|||
20-abx651144 | Abbexa |
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
|||
20-abx651145 | Abbexa |
|
|
Human Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
|||
20-abx490287 | Abbexa |
|
|
ELISA kit for Human Ab1-40 (Amyloid Beta Peptide 1-40) |
|||
ELK1492 | ELK Biotech | 1 plate of 96 wells | EUR 518.4 |
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-CPA864Hu11 | Cloud-Clone |
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-CPA864Hu21 | Cloud-Clone |
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-CPA864Hu23 | Cloud-Clone |
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-CPA864Hu31 | Cloud-Clone |
|
|
Description: Recombinant Human Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-CPA864Mu11 | Cloud-Clone |
|
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-CPA864Mu21 | Cloud-Clone |
|
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-CPA864Mu31 | Cloud-Clone |
|
|
Description: Recombinant Mouse Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
BSA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-CPA864Ra11 | Cloud-Clone |
|
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
OVA Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-CPA864Ra21 | Cloud-Clone |
|
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
KLH Conjugated Amyloid Beta Peptide 1-40 (Ab1-40) |
|||
4-CPA864Ra31 | Cloud-Clone |
|
|
Description: Recombinant Rat Amyloid Beta Peptide 1-40 expressed in: Protein conjugation |
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
|||
20-abx651146 | Abbexa |
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
|||
20-abx651147 | Abbexa |
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
|||
20-abx651148 | Abbexa |
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (BSA) |
|||
20-abx651149 | Abbexa |
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (OVA) |
|||
20-abx651150 | Abbexa |
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) Peptide (KLH) |
|||
20-abx651151 | Abbexa |
|
|
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
|||
20-abx490288 | Abbexa |
|
|
Rat Amyloid Beta Peptide 1-40 (Ab1-40) CLIA Kit |
|||
20-abx490289 | Abbexa |
|
|
ELISA kit for Mouse Ab1-40 (Amyloid Beta Peptide 1-40) |
|||
ELK1493 | ELK Biotech | 1 plate of 96 wells | EUR 518.4 |
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Rat Ab1-40 (Amyloid Beta Peptide 1-40) |
|||
ELK1494 | ELK Biotech | 1 plate of 96 wells | EUR 518.4 |
Description: A competitive Inhibition ELISA kit for detection of Amyloid Beta Peptide 1-40 from Rat in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-1 | ApexBio | 1 mg | EUR 226.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat) |
|||
4-PAA864Ra08 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40) |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC |
|||
4-PAA864Ra08-APC | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Biotinylated |
|||
4-PAA864Ra08-Biotin | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Biotin. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), Cy3 |
|||
4-PAA864Ra08-Cy3 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with Cy3. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), FITC |
|||
4-PAA864Ra08-FITC | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with FITC. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), HRP |
|||
4-PAA864Ra08-HRP | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with HRP. |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), PE |
|||
4-PAA864Ra08-PE | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with PE. |
Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit |
|||
STJ150127 | St John's Laboratory | 1 kit | EUR 494.4 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids |
Human amyloid beta peptide 1-40, Aò1-40 ELISA Kit |
|||
1-CSB-E08299h | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aò1-40 in samples from serum, tissue homogenates, cerebrospinalfluid(CSF). Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit |
|||
STJ150003 | St John's Laboratory | 1 kit | EUR 494.4 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids |
Amyloid Beta Peptide 1-40 (Ab1-40) Polyclonal Antibody (Rat), APC-Cy7 |
|||
4-PAA864Ra08-APC-Cy7 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Rat Amyloid Beta Peptide 1-40 (Ab1-40). This antibody is labeled with APC-Cy7. |
Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
CN-03356H1 | ChemNorm | 96T | EUR 544.8 |
Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
CN-03356H2 | ChemNorm | 48T | EUR 363.6 |
Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
GA-E1247HM-48T | GenAsia Biotech | 48T | EUR 346.8 |
Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
GA-E1247HM-96T | GenAsia Biotech | 96T | EUR 559.2 |
Human amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
QY-E04414 | Qayee Biotechnology | 96T | EUR 433.2 |
Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
YLA1751HU-48T | Shanghai YL Biotech | 48T | EUR 435 |
Human amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
YLA1751HU-96T | Shanghai YL Biotech | 96T | EUR 562.5 |
Mouse amyloid beta peptide 1-40, Aò1-40 ELISA Kit |
|||
1-CSB-E08300m | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aò1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat amyloid beta peptide 1-40, Aò1-40 ELISA Kit |
|||
1-CSB-E08302r | Cusabio |
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aò1-40 in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human amyloid beta peptide 1-40,A?1-40 ELISA Kit |
|||
201-12-1231 | SunredBio | 96 tests | EUR 528 |
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human amyloid beta peptide 1-40, Aò1-40 ELISA Kit |
|||
CSB-E08299h-24T | Cusabio | 1 plate of 24 wells | EUR 198 |
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta peptide 1-40, Aò1-40 in samples from serum, tissue homogenates, cerebrospinalfluid (CSF). A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-10 | ApexBio | 10 mg | EUR 895.2 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-25 | ApexBio | 25 mg | EUR 1228.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Amyloid Beta-Peptide (1-40) (human) |
|||
A1124-5 | ApexBio | 5 mg | EUR 560.4 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
CN-00638R1 | ChemNorm | 96T | EUR 577.2 |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
CN-00638R2 | ChemNorm | 48T | EUR 398.4 |
Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
CN-02744M1 | ChemNorm | 96T | EUR 553.2 |
Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
CN-02744M2 | ChemNorm | 48T | EUR 372 |
Horse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
CN-05164H1 | ChemNorm | 96T | EUR 556.8 |
Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
CN-01866R1 | ChemNorm | 96T | EUR 592.8 |
Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
GA-E0318MS-48T | GenAsia Biotech | 48T | EUR 403.2 |
Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
GA-E0318MS-96T | GenAsia Biotech | 96T | EUR 640.8 |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
GA-E0029RB-48T | GenAsia Biotech | 48T | EUR 391.2 |
Rabbit amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
GA-E0029RB-96T | GenAsia Biotech | 96T | EUR 628.8 |
Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
GA-E0086PC-48T | GenAsia Biotech | 48T | EUR 436.8 |
Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
GA-E0086PC-96T | GenAsia Biotech | 96T | EUR 708 |
Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
GA-E0101RT-48T | GenAsia Biotech | 48T | EUR 380.4 |
Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
GA-E0101RT-96T | GenAsia Biotech | 96T | EUR 595.2 |
Rat amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
QY-E11552 | Qayee Biotechnology | 96T | EUR 433.2 |
Equine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
QY-E120008 | Qayee Biotechnology | 96T | EUR 573.6 |
Mouse amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
QY-E20080 | Qayee Biotechnology | 96T | EUR 433.2 |
Canine Amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
YLA0030CA-48T | Shanghai YL Biotech | 48T | EUR 502.5 |
Canine Amyloid beta peptide 1-40(Aβ1-40)ELISA Kit |
|||
YLA0030CA-96T | Shanghai YL Biotech | 96T | EUR 618.75 |
Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
YLA0171PO-48T | Shanghai YL Biotech | 48T | EUR 502.5 |
Porcine amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
YLA0171PO-96T | Shanghai YL Biotech | 96T | EUR 618.75 |
Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
YLA0371RA-48T | Shanghai YL Biotech | 48T | EUR 465 |
Rat amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
YLA0371RA-96T | Shanghai YL Biotech | 96T | EUR 600 |
Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
YLA0422MO-48T | Shanghai YL Biotech | 48T | EUR 465 |
Mouse amyloid beta peptide 1-40,Aβ1-40 ELISA Kit |
|||
YLA0422MO-96T | Shanghai YL Biotech | 96T | EUR 600 |
Rat beta-40(Amyloid Beta 1-40) ELISA Kit |
|||
STJ150091 | St John's Laboratory | 1 kit | EUR 494.4 |
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids |
Abeta 40 (beta amyloid 1-40) |
|||
RA25009 | Neuromics | 100 ul | EUR 459.6 |
Mouse amyloid beta peptide 1-40, Aò1-40 ELISA Kit |
|||
CSB-E08300m-24T | Cusabio | 1 plate of 24 wells | EUR 198 |
Description: Quantitativesandwich ELISA kit for measuring Mouse amyloid beta peptide 1-40, Aò1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Rat amyloid beta peptide 1-40, Aò1-40 ELISA Kit |
|||
CSB-E08302r-24T | Cusabio | 1 plate of 24 wells | EUR 198 |
Description: Quantitativesandwich ELISA kit for measuring Rat amyloid beta peptide 1-40, Aò1-40 in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human amyloid beta peptide 1-40 ELISA kit |
|||
E01A0910-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human amyloid beta peptide 1-40 ELISA kit |
|||
E01A0910-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human amyloid beta peptide 1-40 ELISA kit |
|||
E01A0910-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human amyloid beta peptide 1- 40 ELISA Kit |
|||
ELA-E0864h | Lifescience Market | 96 Tests | EUR 988.8 |
beta-Amyloid(40-1) |
|||
5-00456 | CHI Scientific | 4 x 1mg | Ask for price |
Human Amyloid-beta (AB1-40) ELISA Kit, 96 tests, Quantitative |
|||
200-100-A40 | Alpha Diagnostics | 1 kit | EUR 973.2 |
Rabbit amyloid beta peptide 1-40 ELISA kit |
|||
E04A0910-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit amyloid beta peptide 1-40 ELISA kit |
|||
E04A0910-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit amyloid beta peptide 1-40 ELISA kit |
|||
E04A0910-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat amyloid beta peptide 1-40 ELISA kit |
|||
E02A0910-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat amyloid beta peptide 1-40 ELISA kit |
|||
E02A0910-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat amyloid beta peptide 1-40 ELISA kit |
|||
E02A0910-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey amyloid beta peptide 1-40 ELISA kit |
|||
E09A0910-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey amyloid beta peptide 1-40 ELISA kit |
|||
E09A0910-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey amyloid beta peptide 1-40 ELISA kit |
|||
E09A0910-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat amyloid beta peptide 1-40 ELISA kit |
|||
E06A0910-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat amyloid beta peptide 1-40 ELISA kit |
|||
E06A0910-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat amyloid beta peptide 1-40 ELISA kit |
|||
E06A0910-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog amyloid beta peptide 1-40 ELISA kit |
|||
E08A0910-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog amyloid beta peptide 1-40 ELISA kit |
|||
E08A0910-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog amyloid beta peptide 1-40 ELISA kit |
|||
E08A0910-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse amyloid beta peptide 1-40 ELISA kit |
|||
E03A0910-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse amyloid beta peptide 1-40 ELISA kit |
|||
E03A0910-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse amyloid beta peptide 1-40 ELISA kit |
|||
E03A0910-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig amyloid beta peptide 1-40 ELISA kit |
|||
E07A0910-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig amyloid beta peptide 1-40 ELISA kit |
|||
E07A0910-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig amyloid beta peptide 1-40 ELISA kit |
|||
E07A0910-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Equine amyloid beta peptide 1- 40 ELISA Kit |
|||
ELA-E0864ELA-Eq | Lifescience Market | 96 Tests | EUR 1113.6 |
Monkey amyloid beta peptide 1- 40 ELISA Kit |
|||
ELA-E0864Mo | Lifescience Market | 96 Tests | EUR 1113.6 |
Rabbit amyloid beta peptide 1- 40 ELISA Kit |
|||
ELA-E0864Rb | Lifescience Market | 96 Tests | EUR 1113.6 |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
DLR-Ab1-42-Hu-48T | DL Develop | 48T | EUR 574.8 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
DLR-Ab1-42-Hu-96T | DL Develop | 96T | EUR 745.2 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RD-Ab1-42-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 573.6 |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RD-Ab1-42-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 794.4 |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RDR-Ab1-42-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 600 |
Human Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RDR-Ab1-42-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 830.4 |
ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Ā Kit |
|||
KTE101179-48T | Abbkine | 48T | EUR 424.8 |
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Ā Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Ā Kit |
|||
KTE101179-5platesof96wells | Abbkine | 5 plates of 96 wells | EUR 2702.4 |
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Ā Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Ā Kit |
|||
KTE101179-96T | Abbkine | 96T | EUR 686.4 |
Description: Quantitative sandwich ELISA for measuring Rat Amyloid Beta Peptide 1-40 (ABeta 1-40) Ā Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
40 x ELISA Wash Buffer |
|||
GR103014-40 | Genorise Scientific | 1 L | EUR 238.8 |
ELISA kit for Human A?1-40 (Amyloid Beta 1-40) |
|||
E-EL-H0542 | Elabscience Biotech | 1 plate of 96 wells | EUR 452.4 |
Description: A sandwich ELISA kit for quantitative measurement of Human A?1-40 (Amyloid Beta 1-40) in samples from Serum, Plasma, Cell supernatant |
FUNNEL, 40 MM, PP |
|||
6120P-40 | CORNING | 24/pk | EUR 52.8 |
Description: Reusable Plastics; Reusable Funnels |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
DLR-Ab1-42-Mu-48T | DL Develop | 48T | EUR 586.8 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
DLR-Ab1-42-Mu-96T | DL Develop | 96T | EUR 762 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
DLR-Ab1-42-Ra-48T | DL Develop | 48T | EUR 609.6 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
DLR-Ab1-42-Ra-96T | DL Develop | 96T | EUR 793.2 |
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-42 (Ab1-42) in samples from serum, plasma or other biological fluids. |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RD-Ab1-42-Mu-48Tests | Reddot Biotech | 48 Tests | EUR 586.8 |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RD-Ab1-42-Mu-96Tests | Reddot Biotech | 96 Tests | EUR 812.4 |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RD-Ab1-42-Ra-48Tests | Reddot Biotech | 48 Tests | EUR 613.2 |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RD-Ab1-42-Ra-96Tests | Reddot Biotech | 96 Tests | EUR 850.8 |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RDR-Ab1-42-Mu-48Tests | Reddot Biotech | 48 Tests | EUR 613.2 |
Mouse Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RDR-Ab1-42-Mu-96Tests | Reddot Biotech | 96 Tests | EUR 850.8 |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RDR-Ab1-42-Ra-48Tests | Reddot Biotech | 48 Tests | EUR 640.8 |
Rat Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit |
|||
RDR-Ab1-42-Ra-96Tests | Reddot Biotech | 96 Tests | EUR 890.4 |
Guinea pig amyloid beta peptide 1-40 ELISA kit |
|||
E05A0910-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Guinea pig amyloid beta peptide 1-40 ELISA kit |
|||
E05A0910-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Guinea pig amyloid beta peptide 1-40 ELISA kit |
|||
E05A0910-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human beta-Amyloid 1-40 (full length) peptide |
|||
BAM400-P | Alpha Diagnostics | 100 ug | EUR 196.8 |
Human beta-Amyloid 1-40 (full length) peptide |
|||
BAM400-P1000 | Alpha Diagnostics | 1000 ug | EUR 416.4 |
Human Beta-Amyloid 1-40 Control/blocking peptide |
|||
BAM402-P | Alpha Diagnostics | 100 ug | EUR 196.8 |
[Gln11] -beta- Amyloid (1 - 40) |
|||
5-00187 | CHI Scientific | 4 x 1mg | Ask for price |
[Gln22] -beta- Amyloid (1 - 40) |
|||
5-00190 | CHI Scientific | 4 x 1mg | Ask for price |
[Gly22] -beta- Amyloid (1 - 40) |
|||
5-00201 | CHI Scientific | 4 x 1mg | Ask for price |
beta-Amyloid (1-40), rat |
|||
5-00427 | CHI Scientific | 4 x 1mg | Ask for price |
Cys-beta- Amyloid (1 - 40) |
|||
5-01014 | CHI Scientific | 4 x 1mg | Ask for price |